Recombinant Human MST1R Protein, GST-tagged

Cat.No. : MST1R-5673H
Product Overview : Human MST1R partial ORF ( NP_002438, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]
Molecular Mass : 36.63 kDa
AA Sequence : DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase) [ Homo sapiens ]
Official Symbol MST1R
Synonyms MST1R; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); PTK8, PTK8 protein tyrosine kinase 8 , RON; macrophage-stimulating protein receptor; CD136; CDw136; p185-Ron; MSP receptor; RON variant E2E3; MST1R variant RON30; MST1R variant RON62; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4; c-met-related tyrosine kinase; PTK8 protein tyrosine kinase 8; RON; PTK8;
Gene ID 4486
mRNA Refseq NM_001244937
Protein Refseq NP_001231866
MIM 600168
UniProt ID Q04912

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MST1R Products

Required fields are marked with *

My Review for All MST1R Products

Required fields are marked with *

0
cart-icon