Recombinant Human MSTN protein
Cat.No. : | MSTN-15H |
Product Overview : | Recombinant Human MSTN(Lys262-Ser375) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | 262-375 a.a. |
Description : | Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
AA Sequence : | KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHL VHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | MSTN myostatin [ Homo sapiens ] |
Official Symbol | MSTN |
Synonyms | MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP; |
Gene ID | 2660 |
mRNA Refseq | NM_005259 |
Protein Refseq | NP_005250 |
MIM | 601788 |
UniProt ID | O14793 |
Chromosome Location | 2q32.1 |
Pathway | Hypertrophy Model, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding; |
◆ Recombinant Proteins | ||
MSTN-2458H | Recombinant Human MSTN Protein, His-tagged | +Inquiry |
Mstn-490M | Recombinant Mouse Mstn protein(Asp268-Ser376), hFc-tagged | +Inquiry |
Mstn-91M | Recombinant Mouse Mstn Protein, His (Fc)-Avi-tagged | +Inquiry |
MSTN-711C | Recombinant Cynomolgus MSTN Protein, His-tagged | +Inquiry |
MSTN-2880R | Recombinant Rhesus monkey MSTN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *