Recombinant Human MSTN protein

• Cat.No.: MSTN-15H
• Product Overview: Recombinant Human MSTN(Lys262-Ser375) was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: 262-375 a.a.
• Description: Growth/differentiation factor 8(Mstn, GDF-8) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. It is expressed specifically in developing and adult skeletal muscle. It exists as a homodimer, and interacts with WFIKKN2, leading to inhibit its activity. This protein can act specifically as a negative regulator of skeletal muscle growth. It regulates cell growth and differentiation in both embryonic and adult tissues.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
• AA Sequence: KRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHL VHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: MSTN myostatin [ Homo sapiens ]
• Official Symbol: MSTN
• Synonyms: MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP
• Gene ID: 2660
• mRNA Refseq: NM_005259
• Protein Refseq: NP_005250
• MIM: 601788
• UniProt ID: O14793
• Chromosome Location: 2q32.1
• Pathway: Hypertrophy Model, organism-specific biosystem
• Function: cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding