Recombinant Human MSTN protein

Cat.No. : MSTN-01H
Product Overview : Recombinant Human MSTN was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals.
Form : 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT
Molecular Mass : ~13 kDa
AA Sequence : DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTLTPKMSPINMLYFNGKEQIIYGKIPAMVVDRCSCG
Purity : > 95% as determined by SDS-PAGE
Storage : Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.1 mg/ml
Gene Name MSTN myostatin [ Homo sapiens ]
Official Symbol MSTN
Synonyms MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID 2660
mRNA Refseq NM_005259
Protein Refseq NP_005250
MIM 601788
UniProt ID O14793
Chromosome Location 2q32.1
Pathway Hypertrophy Model, organism-specific biosystem;
Function cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSTN Products

Required fields are marked with *

My Review for All MSTN Products

Required fields are marked with *

0
cart-icon