Recombinant Human MSTN protein
Cat.No. : | MSTN-01H |
Product Overview : | Recombinant Human MSTN was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals. |
Form : | 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT |
Molecular Mass : | ~13 kDa |
AA Sequence : | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTLTPKMSPINMLYFNGKEQIIYGKIPAMVVDRCSCG |
Purity : | > 95% as determined by SDS-PAGE |
Storage : | Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.1 mg/ml |
Gene Name | MSTN myostatin [ Homo sapiens ] |
Official Symbol | MSTN |
Synonyms | MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP; |
Gene ID | 2660 |
mRNA Refseq | NM_005259 |
Protein Refseq | NP_005250 |
MIM | 601788 |
UniProt ID | O14793 |
Chromosome Location | 2q32.1 |
Pathway | Hypertrophy Model, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding; |
◆ Recombinant Proteins | ||
MSTN-1563H | Recombinant human MSTN, Active, His-tagged | +Inquiry |
Mstn-6388R | Recombinant Rat Mstn Protein, His (Fc)-Avi-tagged | +Inquiry |
MSTN-1752C | Recombinant Cattle MSTN protein, His-tagged | +Inquiry |
Mstn-490M | Recombinant Mouse Mstn protein(Asp268-Ser376), hFc-tagged | +Inquiry |
MSTN-3340H | Recombinant Human MSTN Protein (Lys262-Ser375) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *