Recombinant Human MSTN protein

• Cat.No.: MSTN-01H
• Product Overview: Recombinant Human MSTN was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals.
• Form: 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT
• Molecular Mass: ~13 kDa
• AA Sequence: DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTLTPKMSPINMLYFNGKEQIIYGKIPAMVVDRCSCG
• Purity: > 95% as determined by SDS-PAGE
• Storage: Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: MSTN myostatin [ Homo sapiens ]
• Official Symbol: MSTN
• Synonyms: MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP
• Gene ID: 2660
• mRNA Refseq: NM_005259
• Protein Refseq: NP_005250
• MIM: 601788
• UniProt ID: O14793
• Chromosome Location: 2q32.1
• Pathway: Hypertrophy Model, organism-specific biosystem
• Function: cytokine activity; growth factor activity; receptor binding; contributes_to receptor binding