Recombinant Human MT-ND1
Cat.No. : | MT-ND1-30257TH |
Product Overview : | Recombinant fragment of Human MT-ND1 with N terminal proprietary tag; Predicted MWt 31.24 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 51 amino acids |
Molecular Weight : | 31.240kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY |
Sequence Similarities : | Belongs to the complex I subunit 1 family. |
Gene Name | MT-ND1 mitochondrially encoded NADH dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | MT-ND1 |
Synonyms | MT-ND1; mitochondrially encoded NADH dehydrogenase 1; MTND1, NADH dehydrogenase 1; NADH dehydrogenase, subunit 1 (complex I); complex I ND1 subunit; NAD1; NADH ubiquinone oxidoreductase chain 1; ND1; |
Gene ID | 4535 |
Uniprot ID | P03886 |
Chromosome Location | mitochondria |
Pathway | Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem; |
Function | NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT-ND1 Products
Required fields are marked with *
My Review for All MT-ND1 Products
Required fields are marked with *
0
Inquiry Basket