Recombinant Human MT1F, GST-tagged

Cat.No. : MT1F-125H
Product Overview : Recombinant Human MT1F(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metallothionein-1F is a protein that in humans is encoded by the MT1F gene.
Molecular Mass : 32.45 kDa
AA Sequence : MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MT1F metallothionein 1F [ Homo sapiens (human) ]
Official Symbol MT1F
Synonyms MT1F; MT1; metallothionein 1F; metallothionein-1F; MT-1F; MT-IF; metallothionein-IF; metallothionein 1F (functional)
Gene ID 4494
mRNA Refseq NM_001301272
Protein Refseq NP_001288201
MIM 156352
UniProt ID P04733
Chromosome Location 16q13
Pathway Mineral absorption
Function zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT1F Products

Required fields are marked with *

My Review for All MT1F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon