Recombinant Human MT1X, GST-tagged

• Cat.No.: MT1X-129H
• Product Overview: Recombinant Human MT1X(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Metallothionein 1X, also known as MT1X, is a protein which in humans is encoded by the gene.
• Molecular Mass: 33.11 kDa
• AA Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT1X metallothionein 1X [ Homo sapiens (human) ]
• Official Symbol: MT1X
• Synonyms: MT1X; MT1; MT-1l; metallothionein 1X; metallothionein-1X; MT-1X; MT-IX; metallothionein-IX
• Gene ID: 4501
• mRNA Refseq: NM_005952
• Protein Refseq: NP_005943
• MIM: 156359
• UniProt ID: P80297
• Chromosome Location: 16q13
• Pathway: Mineral absorption; Oxidative Stress
• Function: metal ion binding; zinc ion binding