Recombinant Human MT1X protein, GST-tagged
| Cat.No. : | MT1X-1302H |
| Product Overview : | Recombinant Human MT1X protein(NP_005943)(1-46 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-46 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | MT1X metallothionein 1X [ Homo sapiens (human) ] |
| Official Symbol | MT1X |
| Synonyms | MT1; MT-1l |
| Gene ID | 4501 |
| mRNA Refseq | NM_005952.4 |
| Protein Refseq | NP_005943 |
| MIM | 156359 |
| UniProt ID | P80297 |
| ◆ Recombinant Proteins | ||
| MT1X-2707R | Recombinant Rhesus Macaque MT1X Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT1X-3774H | Recombinant Human MT1X protein, His-tagged | +Inquiry |
| MT1X-3534H | Recombinant Human MT1X Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT1X-1302H | Recombinant Human MT1X protein, GST-tagged | +Inquiry |
| MT1X-130H | Recombinant Human MT1X Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1X Products
Required fields are marked with *
My Review for All MT1X Products
Required fields are marked with *




