Recombinant Human MT2A protein, GST-tagged
| Cat.No. : | MT2A-3250H |
| Product Overview : | Recombinant Human MT2A protein(P02795)(1-59aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-59aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.9 kDa |
| AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MT2A metallothionein 2A [ Homo sapiens ] |
| Official Symbol | MT2A |
| Synonyms | MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II; |
| Gene ID | 4502 |
| mRNA Refseq | NM_005953 |
| Protein Refseq | NP_005944 |
| MIM | 156360 |
| UniProt ID | P02795 |
| ◆ Recombinant Proteins | ||
| MT2A-7000HF | Recombinant Full Length Human MT2A Protein, GST-tagged | +Inquiry |
| MT2A-4615H | Recombinant Human MT2A Protein (Met1-Ala61), N-GST tagged | +Inquiry |
| Mt2A-1898R | Recombinant Rat Mt2A protein, His & GST-tagged | +Inquiry |
| MT2A-1200HFL | Recombinant Full Length Human MT2A Protein, C-Flag-tagged | +Inquiry |
| MT2A-1071H | Recombinant Human MT2A, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *
