Recombinant Human MT3
Cat.No. : | MT3-29501TH |
Product Overview : | Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 68 amino acids |
Description : | Metallothionein-3 is a protein that in humans is encoded by the MT3 gene. |
Molecular Weight : | 33.480kDa inclusive of tags |
Tissue specificity : | Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Sequence Similarities : | Belongs to the metallothionein superfamily. Type 1 family. |
Gene Name | MT3 metallothionein 3 [ Homo sapiens ] |
Official Symbol | MT3 |
Synonyms | MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; |
Gene ID | 4504 |
mRNA Refseq | NM_005954 |
Protein Refseq | NP_005945 |
MIM | 139255 |
Uniprot ID | P25713 |
Chromosome Location | 16q13 |
Function | antioxidant activity; copper ion binding; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
MT3-5761M | Recombinant Mouse MT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MT3-29501TH | Recombinant Human MT3 | +Inquiry |
MT3-131H | Recombinant Human MT3, GST-tagged | +Inquiry |
MT3-438H | Recombinant Human metallothionein 3, His-tagged | +Inquiry |
MT3-2889R | Recombinant Rhesus monkey MT3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT3 Products
Required fields are marked with *
My Review for All MT3 Products
Required fields are marked with *