Recombinant Human MT3
| Cat.No. : | MT3-29501TH |
| Product Overview : | Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 68 amino acids |
| Description : | Metallothionein-3 is a protein that in humans is encoded by the MT3 gene. |
| Molecular Weight : | 33.480kDa inclusive of tags |
| Tissue specificity : | Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| Sequence Similarities : | Belongs to the metallothionein superfamily. Type 1 family. |
| Gene Name | MT3 metallothionein 3 [ Homo sapiens ] |
| Official Symbol | MT3 |
| Synonyms | MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; |
| Gene ID | 4504 |
| mRNA Refseq | NM_005954 |
| Protein Refseq | NP_005945 |
| MIM | 139255 |
| Uniprot ID | P25713 |
| Chromosome Location | 16q13 |
| Function | antioxidant activity; copper ion binding; metal ion binding; zinc ion binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT3 Products
Required fields are marked with *
My Review for All MT3 Products
Required fields are marked with *




