Recombinant Human MT3

Cat.No. : MT3-29501TH
Product Overview : Recombinant full length Human MT3 with N-terminal proprietary tag. Predicted MW 33.48kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 68 amino acids
Description : Metallothionein-3 is a protein that in humans is encoded by the MT3 gene.
Molecular Weight : 33.480kDa inclusive of tags
Tissue specificity : Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Sequence Similarities : Belongs to the metallothionein superfamily. Type 1 family.
Gene Name MT3 metallothionein 3 [ Homo sapiens ]
Official Symbol MT3
Synonyms MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF;
Gene ID 4504
mRNA Refseq NM_005954
Protein Refseq NP_005945
MIM 139255
Uniprot ID P25713
Chromosome Location 16q13
Function antioxidant activity; copper ion binding; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT3 Products

Required fields are marked with *

My Review for All MT3 Products

Required fields are marked with *

0
cart-icon