Recombinant Human MT3, GST-tagged
| Cat.No. : | MT3-131H |
| Product Overview : | Recombinant Human MT3(1 a.a. - 68 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Metallothionein-3 is a protein that in humans is encoded by the MT3 gene. |
| Molecular Mass : | 33.11 kDa |
| AA Sequence : | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MT3 metallothionein 3 [ Homo sapiens (human) ] |
| Official Symbol | MT3 |
| Synonyms | MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; MT-3; MT-III; metallothionein-III; growth inhibitory factor; GIFB; GRIF; ZnMT3 |
| Gene ID | 4504 |
| mRNA Refseq | NM_005954 |
| Protein Refseq | NP_005945 |
| MIM | 139255 |
| UniProt ID | P25713 |
| Chromosome Location | 16q13 |
| Function | antioxidant activity; cadmium ion binding; copper ion binding; copper ion binding; cysteine-type endopeptidase inhibitor activity involved in apoptotic process; drug binding; metal ion binding; protein binding; protein kinase activator activity; zinc ion binding |
| ◆ Recombinant Proteins | ||
| MT3-10159M | Recombinant Mouse MT3 Protein | +Inquiry |
| MT3-320HF | Recombinant Full Length Human MT3 Protein | +Inquiry |
| MT3-7002HF | Recombinant Full Length Human MT3 Protein, GST-tagged | +Inquiry |
| Mt3-832M | Recombinant Mouse Mt3 protein, His & T7-tagged | +Inquiry |
| MT3-3800R | Recombinant Rat MT3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT3 Products
Required fields are marked with *
My Review for All MT3 Products
Required fields are marked with *
