Recombinant Human MT3 protein, His-SUMO-tagged
Cat.No. : | MT3-3251H |
Product Overview : | Recombinant Human MT3 protein(P25713)(1-68aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-68aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.9 kDa |
AA Sequence : | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MT3 metallothionein 3 [ Homo sapiens ] |
Official Symbol | MT3 |
Synonyms | MT3; metallothionein 3; metallothionein 3 (growth inhibitory factor (neurotrophic)); metallothionein-3; GIF; MT-3; MT-III; metallothionein-III; growth inhibitory factor; GIFB; GRIF; ZnMT3; |
Gene ID | 4504 |
mRNA Refseq | NM_005954 |
Protein Refseq | NP_005945 |
MIM | 139255 |
UniProt ID | P25713 |
◆ Recombinant Proteins | ||
Mt3-832M | Recombinant Mouse Mt3 protein, His & T7-tagged | +Inquiry |
MT3-438H | Recombinant Human metallothionein 3, His-tagged | +Inquiry |
MT3-29501TH | Recombinant Human MT3 | +Inquiry |
MT3-4616H | Recombinant Human MT3 Protein (Met1-Gln68), N-GST tagged | +Inquiry |
MT3-26H | Recombinant Human MT3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT3 Products
Required fields are marked with *
My Review for All MT3 Products
Required fields are marked with *