"MT4" Related Products

Expand
Expand

Recombinant Human MT4 Protein, His-SUMO-tagged

Cat.No.: MT4-135H
Product Overview: Recombinant Human MT4 Protein (1-62aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source: E. coli
Species: Human
Tag : His-SUMO
Form: Tris-based buffer,50% glycerol
Molecular Mass: 22.5 kDa
AA Sequence: MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Purity: Greater than 85% as determined by SDS-PAGE
Storage: Store at -20 centigrade/-80 centigrade.
Gene Name: MT4 metallothionein 4 [ Homo sapiens (human) ]
Official Symbol: MT4
Synonyms: MT-4; MTIV; MT-IV
Gene ID: 84560
mRNA Refseq: NM_032935.2
Protein Refseq: NP_116324.1
MIM: 606206
UniProt ID: P47944

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.