Recombinant Human MT4 Protein, His-SUMO-tagged
Cat.No. : | MT4-135H |
Product Overview : | Recombinant Human MT4 Protein (1-62aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-62 a.a. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP |
Purity : | Greater than 85% as determined by SDS-PAGE |
Storage : | Store at -20 centigrade/-80 centigrade. |
Gene Name | MT4 metallothionein 4 [ Homo sapiens (human) ] |
Official Symbol | MT4 |
Synonyms | MT-4; MTIV; MT-IV |
Gene ID | 84560 |
mRNA Refseq | NM_032935.2 |
Protein Refseq | NP_116324.1 |
MIM | 606206 |
UniProt ID | P47944 |
◆ Recombinant Proteins | ||
MT4-6827C | Recombinant Chicken MT4 | +Inquiry |
MT4-7004HF | Recombinant Full Length Human MT4 Protein, GST-tagged | +Inquiry |
MT4-783H | Recombinant Human MT4 | +Inquiry |
MT4-135H | Recombinant Human MT4 Protein, His-SUMO-tagged | +Inquiry |
MT4-3535H | Recombinant Human MT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT4-4094HCL | Recombinant Human MT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT4 Products
Required fields are marked with *
My Review for All MT4 Products
Required fields are marked with *