Recombinant Human MT4 Protein, His-SUMO-tagged

Cat.No. : MT4-135H
Product Overview : Recombinant Human MT4 Protein (1-62aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-62 a.a.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.5 kDa
AA Sequence : MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Purity : Greater than 85% as determined by SDS-PAGE
Storage : Store at -20 centigrade/-80 centigrade.
Gene Name MT4 metallothionein 4 [ Homo sapiens (human) ]
Official Symbol MT4
Synonyms MT-4; MTIV; MT-IV
Gene ID 84560
mRNA Refseq NM_032935.2
Protein Refseq NP_116324.1
MIM 606206
UniProt ID P47944

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT4 Products

Required fields are marked with *

My Review for All MT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon