"MT4" Related Products

Expand
Expand

Recombinant Human MT4 Protein, His-SUMO-tagged

Cat.No. : MT4-135H
Product Overview : Recombinant Human MT4 Protein (1-62aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.5 kDa
AA Sequence : MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Purity : Greater than 85% as determined by SDS-PAGE
Storage : Store at -20 centigrade/-80 centigrade.
Gene Name : MT4 metallothionein 4 [ Homo sapiens (human) ]
Official Symbol : MT4
Synonyms : MT-4; MTIV; MT-IV
Gene ID : 84560
mRNA Refseq : NM_032935.2
Protein Refseq : NP_116324.1
MIM : 606206
UniProt ID : P47944

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.