Recombinant Human MTA1, His-tagged
Cat.No. : | MTA1-29503TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 105-452 of Human MTA1 with N terminal His tag; 348 amino acids, 40kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 105-452 a.a. |
Description : | This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. High expression in brain, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLERE DFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLK EGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGT FARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHK NIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEE ALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQ QKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGV VNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQC RLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHG |
Sequence Similarities : | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
Gene Name | MTA1 metastasis associated 1 [ Homo sapiens ] |
Official Symbol | MTA1 |
Synonyms | MTA1; metastasis associated 1; metastasis-associated protein MTA1; |
Gene ID | 9112 |
mRNA Refseq | NM_001203258 |
Protein Refseq | NP_001190187 |
MIM | 603526 |
Uniprot ID | Q13330 |
Chromosome Location | 14q32.33 |
Pathway | Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MTA1-3460R | Recombinant Rat MTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTA1-1137HFL | Recombinant Full Length Human MTA1 Protein, C-Flag-tagged | +Inquiry |
MTA1-2455H | Recombinant Human MTA1 protein, GST-tagged | +Inquiry |
MTA1-2458H | Recombinant Human MTA1 protein, GST-tagged | +Inquiry |
MTA1-1447H | Recombinant Human MTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTA1-4093HCL | Recombinant Human MTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTA1 Products
Required fields are marked with *
My Review for All MTA1 Products
Required fields are marked with *
0
Inquiry Basket