Recombinant Human MTA1, His-tagged

Cat.No. : MTA1-29503TH
Product Overview : Recombinant fragment, corresponding to amino acids 105-452 of Human MTA1 with N terminal His tag; 348 amino acids, 40kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 105-452 a.a.
Description : This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Widely expressed. High expression in brain, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual.
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLERE DFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLK EGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGT FARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHK NIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEE ALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQ QKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGV VNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQC RLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHG
Sequence Similarities : Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain.
Gene Name MTA1 metastasis associated 1 [ Homo sapiens ]
Official Symbol MTA1
Synonyms MTA1; metastasis associated 1; metastasis-associated protein MTA1;
Gene ID 9112
mRNA Refseq NM_001203258
Protein Refseq NP_001190187
MIM 603526
Uniprot ID Q13330
Chromosome Location 14q32.33
Pathway Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTA1 Products

Required fields are marked with *

My Review for All MTA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon