Recombinant Human MTCH1 protein, GST-tagged
| Cat.No. : | MTCH1-185H |
| Product Overview : | Recombinant Human MTCH1(1 a.a. - 363 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-363 a.a. |
| Description : | This gene encodes a member of the mitochondrial carrier family. The encoded protein is localized to the mitochondrion inner membrane and induces apoptosis independent of the proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified for this gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 65.67 kDa |
| AA Sequence : | MDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYI VQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHR LHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDT PGGLGNDQNPGSQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCWKYLS VQVSKHWTAEAFPVLCYILQLKWFCGCFIACKDKWFHGIQYCEEILGIYKAFKFSSYIISERI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage : | Store at -80 centigrade Aliquot to avoid repeated freezing and thawing. |
| Gene Name | MTCH1 mitochondrial carrier 1 [ Homo sapiens ] |
| Official Symbol | MTCH1 |
| Synonyms | MTCH1; mitochondrial carrier 1; mitochondrial carrier homolog 1 (C. elegans); mitochondrial carrier homolog 1; CGI 64; PSAP; SLC25A49; solute carrier family 25; member 49; presenilin-associated protein; solute carrier family 25, member 49; cell proliferation-inducing protein 60; PIG60; CGI-64; MGC131998; |
| Gene ID | 23787 |
| mRNA Refseq | NM_014341 |
| Protein Refseq | NP_055156 |
| MIM | 610449 |
| UniProt ID | Q9NZJ7 |
| Chromosome Location | 6p21.2 |
| Function | protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTCH1 Products
Required fields are marked with *
My Review for All MTCH1 Products
Required fields are marked with *
