Recombinant Human MTCH1 protein, GST-tagged
Cat.No. : | MTCH1-185H |
Product Overview : | Recombinant Human MTCH1(1 a.a. - 363 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-363 a.a. |
Description : | This gene encodes a member of the mitochondrial carrier family. The encoded protein is localized to the mitochondrion inner membrane and induces apoptosis independent of the proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified for this gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 65.67 kDa |
AA Sequence : | MDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYI VQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHR LHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDT PGGLGNDQNPGSQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCWKYLS VQVSKHWTAEAFPVLCYILQLKWFCGCFIACKDKWFHGIQYCEEILGIYKAFKFSSYIISERI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80 centigrade Aliquot to avoid repeated freezing and thawing. |
Gene Name | MTCH1 mitochondrial carrier 1 [ Homo sapiens ] |
Official Symbol | MTCH1 |
Synonyms | MTCH1; mitochondrial carrier 1; mitochondrial carrier homolog 1 (C. elegans); mitochondrial carrier homolog 1; CGI 64; PSAP; SLC25A49; solute carrier family 25; member 49; presenilin-associated protein; solute carrier family 25, member 49; cell proliferation-inducing protein 60; PIG60; CGI-64; MGC131998; |
Gene ID | 23787 |
mRNA Refseq | NM_014341 |
Protein Refseq | NP_055156 |
MIM | 610449 |
UniProt ID | Q9NZJ7 |
Chromosome Location | 6p21.2 |
Function | protein binding; |
◆ Recombinant Proteins | ||
MTCH1-185H | Recombinant Human MTCH1 protein, GST-tagged | +Inquiry |
RFL27405MF | Recombinant Full Length Mouse Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged | +Inquiry |
MTCH1-5643H | Recombinant Human MTCH1 protein, His-tagged | +Inquiry |
RFL34450HF | Recombinant Full Length Human Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged | +Inquiry |
MTCH1-10177M | Recombinant Mouse MTCH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTCH1-4090HCL | Recombinant Human MTCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTCH1 Products
Required fields are marked with *
My Review for All MTCH1 Products
Required fields are marked with *
0
Inquiry Basket