Recombinant Human MTCH1 protein, GST-tagged

• Cat.No.: MTCH1-185H
• Product Overview: Recombinant Human MTCH1(1 a.a. - 363 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-363 a.a.
• Description: This gene encodes a member of the mitochondrial carrier family. The encoded protein is localized to the mitochondrion inner membrane and induces apoptosis independent of the proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified for this gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 65.67 kDa
• AA Sequence: MDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYI VQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHR LHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDT PGGLGNDQNPGSQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCWKYLS VQVSKHWTAEAFPVLCYILQLKWFCGCFIACKDKWFHGIQYCEEILGIYKAFKFSSYIISERI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Storage: Store at -80 centigrade Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MTCH1 mitochondrial carrier 1 [ Homo sapiens ]
• Official Symbol: MTCH1
• Synonyms: MTCH1; mitochondrial carrier 1; mitochondrial carrier homolog 1 (C. elegans); mitochondrial carrier homolog 1; CGI 64; PSAP; SLC25A49; solute carrier family 25; member 49; presenilin-associated protein; solute carrier family 25, member 49; cell proliferation-inducing protein 60; PIG60; CGI-64; MGC131998
• Gene ID: 23787
• mRNA Refseq: NM_014341
• Protein Refseq: NP_055156
• MIM: 610449
• UniProt ID: Q9NZJ7
• Chromosome Location: 6p21.2
• Function: protein binding