Recombinant Human MTCP1 Protein, GST-tagged
Cat.No. : | MTCP1-5688H |
Product Overview : | Human MTCP1 full-length ORF ( AAH02600, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5 exon spliced to two different sets of 3 exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq |
Molecular Mass : | 33 kDa |
AA Sequence : | MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTCP1 mature T-cell proliferation 1 [ Homo sapiens ] |
Official Symbol | MTCP1 |
Synonyms | MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13; |
Gene ID | 4515 |
mRNA Refseq | NM_001018025 |
Protein Refseq | NP_001018025 |
MIM | 300116 |
UniProt ID | P56278 |
◆ Recombinant Proteins | ||
MTCP1-2893R | Recombinant Rhesus monkey MTCP1 Protein, His-tagged | +Inquiry |
MTCP1-6485HF | Recombinant Full Length Human MTCP1 Protein, GST-tagged | +Inquiry |
MTCP1-0455H | Recombinant Human MTCP1 Protein (M1-D107), His/Strep tagged | +Inquiry |
MTCP1-5688H | Recombinant Human MTCP1 Protein, GST-tagged | +Inquiry |
MTCP1-319H | Recombinant Human mature T-cell proliferation 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTCP1-1142HCL | Recombinant Human MTCP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTCP1 Products
Required fields are marked with *
My Review for All MTCP1 Products
Required fields are marked with *