Recombinant Human MTCP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MTCP1-3906H |
Product Overview : | MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MTCP1 mature T-cell proliferation 1 [ Homo sapiens (human) ] |
Official Symbol | MTCP1 |
Synonyms | MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13; |
Gene ID | 4515 |
mRNA Refseq | NM_001018025 |
Protein Refseq | NP_001018025 |
MIM | 300116 |
UniProt ID | P56278 |
◆ Recombinant Proteins | ||
MTCP1-319H | Recombinant Human mature T-cell proliferation 1, His-tagged | +Inquiry |
MTCP1-3906H | Recombinant Human MTCP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTCP1-2190H | Recombinant Human MTCP1 Protein, MYC/DDK-tagged | +Inquiry |
MTCP1-0454H | Recombinant Human MTCP1 Protein (M1-D107), Tag Free | +Inquiry |
MTCP1-2713R | Recombinant Rhesus Macaque MTCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTCP1-1142HCL | Recombinant Human MTCP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTCP1 Products
Required fields are marked with *
My Review for All MTCP1 Products
Required fields are marked with *