Recombinant Human MTCP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MTCP1-3906H
Product Overview : MTCP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018025) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis.
Molecular Mass : 12.4 kDa
AA Sequence : MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MTCP1 mature T-cell proliferation 1 [ Homo sapiens (human) ]
Official Symbol MTCP1
Synonyms MTCP1; mature T-cell proliferation 1; protein p13 MTCP-1; p8MTCP1; P13MTCP1; MTCP-1 type B1; mature T-cell proliferation-1 type B1; mature T-cell proliferation 1 isoform p13;
Gene ID 4515
mRNA Refseq NM_001018025
Protein Refseq NP_001018025
MIM 300116
UniProt ID P56278

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTCP1 Products

Required fields are marked with *

My Review for All MTCP1 Products

Required fields are marked with *

0
cart-icon