Recombinant Human MTHFS Protein, GST-tagged
Cat.No. : | MTHFS-5706H |
Product Overview : | Human MTHFS partial ORF ( NP_006432, 104 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ] |
Official Symbol | MTHFS |
Synonyms | MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; methenyl-THF synthetase; FLJ30410; |
Gene ID | 10588 |
mRNA Refseq | NM_001199758 |
Protein Refseq | NP_001186687 |
MIM | 604197 |
UniProt ID | P49914 |
◆ Recombinant Proteins | ||
MTHFS-3252H | Recombinant Human MTHFS protein, His-SUMO-tagged | +Inquiry |
MTHFS-5296R | Recombinant Rabbit MTHFS protein | +Inquiry |
MTHFS-5295R | Recombinant Rabbit MTHFS protein, Avi-tagged, Biotinylated | +Inquiry |
MTHFS-5880H | Recombinant Human MTHFS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFS-5706H | Recombinant Human MTHFS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFS-4080HCL | Recombinant Human MTHFS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFS Products
Required fields are marked with *
My Review for All MTHFS Products
Required fields are marked with *