Recombinant Human MTHFS protein, His-SUMO-tagged
Cat.No. : | MTHFS-3252H |
Product Overview : | Recombinant Human MTHFS protein(P49914)(2-203aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-203aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ] |
Official Symbol | MTHFS |
Synonyms | MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; methenyl-THF synthetase; FLJ30410; |
Gene ID | 10588 |
mRNA Refseq | NM_001199758 |
Protein Refseq | NP_001186687 |
MIM | 604197 |
UniProt ID | P49914 |
◆ Recombinant Proteins | ||
MTHFS-5781M | Recombinant Mouse MTHFS Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFS-5880H | Recombinant Human MTHFS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFS-3914H | Recombinant Human MTHFS Protein (Met1-Ala203), C-His tagged | +Inquiry |
MTHFS-2719R | Recombinant Rhesus Macaque MTHFS Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFS-2899R | Recombinant Rhesus monkey MTHFS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFS-4080HCL | Recombinant Human MTHFS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTHFS Products
Required fields are marked with *
My Review for All MTHFS Products
Required fields are marked with *
0
Inquiry Basket