Recombinant Human MTHFS protein, His-SUMO-tagged
| Cat.No. : | MTHFS-3252H |
| Product Overview : | Recombinant Human MTHFS protein(P49914)(2-203aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-203aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ] |
| Official Symbol | MTHFS |
| Synonyms | MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; methenyl-THF synthetase; FLJ30410; |
| Gene ID | 10588 |
| mRNA Refseq | NM_001199758 |
| Protein Refseq | NP_001186687 |
| MIM | 604197 |
| UniProt ID | P49914 |
| ◆ Recombinant Proteins | ||
| MTHFS-3914H | Recombinant Human MTHFS Protein (Met1-Ala203), C-His tagged | +Inquiry |
| MTHFS-5296R | Recombinant Rabbit MTHFS protein | +Inquiry |
| MTHFS-01H | Recombinant Human MTHFS Protein, Myc/DDK-tagged | +Inquiry |
| MTHFS-5005C | Recombinant Chicken MTHFS | +Inquiry |
| MTHFS-3252H | Recombinant Human MTHFS protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTHFS-4080HCL | Recombinant Human MTHFS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFS Products
Required fields are marked with *
My Review for All MTHFS Products
Required fields are marked with *
