Recombinant Human MTMR12 protein, His-tagged

Cat.No. : MTMR12-381H
Product Overview : Recombinant Human MTMR12 protein(NP_001035536)(1-350 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHHTQAPKLLKRLFLFSYATAAQNNTVTDPKNHTVMFDTLKDWCWELERTKGNMKYKAVSVNEGYKVCERLPAYFVVPTPLPEENVQRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGILQIQKSFLDGIYKTIHRPPYEIVKTEDLSSNFLSLQEIQTAYSKFKQLFLIDNSTEFWDTD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MTMR12 myotubularin related protein 12 [ Homo sapiens ]
Official Symbol MTMR12
Synonyms MTMR12; myotubularin related protein 12; phosphatidylinositol 3 phosphate associated protein , PIP3AP; myotubularin-related protein 12; 3 PAP; 3PAP; FLJ20476; KIAA1682; 3-phosphatase adapter protein; 3-phosphatase adapter subunit; phosphatidylinositol-3-phosphate associated protein; phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit; phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit; 3-PAP; PIP3AP;
Gene ID 54545
mRNA Refseq NM_001040446
Protein Refseq NP_001035536
MIM 606501
UniProt ID Q9C0I1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTMR12 Products

Required fields are marked with *

My Review for All MTMR12 Products

Required fields are marked with *

0
cart-icon