Recombinant Human MTMR12 protein, His-tagged
| Cat.No. : | MTMR12-381H |
| Product Overview : | Recombinant Human MTMR12 protein(NP_001035536)(1-350 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHHTQAPKLLKRLFLFSYATAAQNNTVTDPKNHTVMFDTLKDWCWELERTKGNMKYKAVSVNEGYKVCERLPAYFVVPTPLPEENVQRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGILQIQKSFLDGIYKTIHRPPYEIVKTEDLSSNFLSLQEIQTAYSKFKQLFLIDNSTEFWDTD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MTMR12 myotubularin related protein 12 [ Homo sapiens ] |
| Official Symbol | MTMR12 |
| Synonyms | MTMR12; myotubularin related protein 12; phosphatidylinositol 3 phosphate associated protein , PIP3AP; myotubularin-related protein 12; 3 PAP; 3PAP; FLJ20476; KIAA1682; 3-phosphatase adapter protein; 3-phosphatase adapter subunit; phosphatidylinositol-3-phosphate associated protein; phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit; phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit; 3-PAP; PIP3AP; |
| Gene ID | 54545 |
| mRNA Refseq | NM_001040446 |
| Protein Refseq | NP_001035536 |
| MIM | 606501 |
| UniProt ID | Q9C0I1 |
| ◆ Recombinant Proteins | ||
| MTMR12-6538HF | Recombinant Full Length Human MTMR12 Protein, GST-tagged | +Inquiry |
| MTMR12-2721R | Recombinant Rhesus Macaque MTMR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTMR12-6342Z | Recombinant Zebrafish MTMR12 | +Inquiry |
| MTMR12-3472R | Recombinant Rat MTMR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTMR12-2901R | Recombinant Rhesus monkey MTMR12 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTMR12 Products
Required fields are marked with *
My Review for All MTMR12 Products
Required fields are marked with *



