Recombinant Human MTMR9 Protein, His-tagged

Species :	Human
Source :	E.coli
Tag :	His
Protein Length :	165-393 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence :	PKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCALSAYCNTKQKWE
Purity :	80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	MTMR9 myotubularin related protein 9 [ Homo sapiens ]
Official Symbol	MTMR9
Synonyms	MTMR9; myotubularin related protein 9; C8orf9, MTMR8, myotubularin related protein 8; myotubularin-related protein 9; DKFZp434K171; LIP STYX; myotubularin related protein 8; MTMR8; C8orf9; LIP-STYX; MGC126672;
Gene ID	66036
mRNA Refseq	NM_015458
Protein Refseq	NP_056273
MIM	606260
UniProt ID	Q96QG7