Recombinant Human MTSS1L protein, GST-tagged

Cat.No. : MTSS1L-7755H
Product Overview : Recombinant Human MTSS1L protein(196-246 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 196-246 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : TFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MTSS1L metastasis suppressor 1-like [ Homo sapiens ]
Official Symbol MTSS1L
Synonyms MTSS1L; metastasis suppressor 1-like; MTSS1-like protein; ABBA 1; actin bundling protein with BAIAP2 homology; LOC92154; actin-bundling protein with BAIAP2 homology; actin-bundling with BAIAP2 homology protein 1; ABBA-1;
Gene ID 92154
mRNA Refseq NM_138383
Protein Refseq NP_612392
UniProt ID Q765P7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTSS1L Products

Required fields are marked with *

My Review for All MTSS1L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon