Recombinant Human MTURN Protein, GST-Tagged
| Cat.No. : | MTURN-0144H |
| Product Overview : | Human MTURN full-length ORF (AAI56840.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MTURN (Maturin, Neural Progenitor Differentiation Regulator Homolog) is a Protein Coding gene. |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTURN maturin, neural progenitor differentiation regulator homolog [ Homo sapiens (human) ] |
| Official Symbol | MTURN |
| Synonyms | MTURN; maturin, neural progenitor differentiation regulator homolog; Ells1; C7orf41; UPF0452 protein C7orf41; maturin neural progenitor differentiation regulator protein homolog; protein Ells1 |
| Gene ID | 222166 |
| mRNA Refseq | NM_152793 |
| Protein Refseq | NP_690006 |
| UniProt ID | Q8N3F0 |
| ◆ Recombinant Proteins | ||
| MTURN-2624HF | Recombinant Full Length Human MTURN Protein, GST-tagged | +Inquiry |
| MTURN-0144H | Recombinant Human MTURN Protein, GST-Tagged | +Inquiry |
| MTURN-7293Z | Recombinant Zebrafish MTURN | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTURN Products
Required fields are marked with *
My Review for All MTURN Products
Required fields are marked with *




