Recombinant Human MTURN Protein, GST-Tagged

Cat.No. : MTURN-0144H
Product Overview : Human MTURN full-length ORF (AAI56840.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MTURN (Maturin, Neural Progenitor Differentiation Regulator Homolog) is a Protein Coding gene.
Molecular Mass : 14.5 kDa
AA Sequence : MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTURN maturin, neural progenitor differentiation regulator homolog [ Homo sapiens (human) ]
Official Symbol MTURN
Synonyms MTURN; maturin, neural progenitor differentiation regulator homolog; Ells1; C7orf41; UPF0452 protein C7orf41; maturin neural progenitor differentiation regulator protein homolog; protein Ells1
Gene ID 222166
mRNA Refseq NM_152793
Protein Refseq NP_690006
UniProt ID Q8N3F0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTURN Products

Required fields are marked with *

My Review for All MTURN Products

Required fields are marked with *

0
cart-icon
0
compare icon