Recombinant Human MUC13 protein, His-tagged

Cat.No. : MUC13-4666H
Product Overview : Recombinant Human MUC13 protein(Q9H3R2)(322-421 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 322-421 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 12.8 kDa
AASequence : LTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name MUC13 mucin 13, cell surface associated [ Homo sapiens ]
Official Symbol MUC13
Synonyms MUC13; mucin 13, cell surface associated; down regulated in colon cancer 1 , DRCC1, mucin 13, epithelial transmembrane; mucin-13; down-regulated in colon cancer 1; mucin 13, epithelial transmembrane; DRCC1; MUC-13; FLJ20063;
Gene ID 56667
mRNA Refseq NM_033049
Protein Refseq NP_149038
MIM 612181
UniProt ID Q9H3R2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC13 Products

Required fields are marked with *

My Review for All MUC13 Products

Required fields are marked with *

0
cart-icon
0
compare icon