Recombinant Human MUC13 protein, His-tagged
| Cat.No. : | MUC13-4666H |
| Product Overview : | Recombinant Human MUC13 protein(Q9H3R2)(322-421 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 322-421 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 12.8 kDa |
| AASequence : | LTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | MUC13 mucin 13, cell surface associated [ Homo sapiens ] |
| Official Symbol | MUC13 |
| Synonyms | MUC13; mucin 13, cell surface associated; down regulated in colon cancer 1 , DRCC1, mucin 13, epithelial transmembrane; mucin-13; down-regulated in colon cancer 1; mucin 13, epithelial transmembrane; DRCC1; MUC-13; FLJ20063; |
| Gene ID | 56667 |
| mRNA Refseq | NM_033049 |
| Protein Refseq | NP_149038 |
| MIM | 612181 |
| UniProt ID | Q9H3R2 |
| ◆ Recombinant Proteins | ||
| MUC13-124H | Recombinant Human MUC13 protein, His-tagged | +Inquiry |
| RFL16458MF | Recombinant Full Length Mouse Mucin-13(Muc13) Protein, His-Tagged | +Inquiry |
| MUC13-1506H | Recombinant Human MUC13 protein, His & T7-tagged | +Inquiry |
| MUC13-10227M | Recombinant Mouse MUC13 Protein | +Inquiry |
| MUC13-5802M | Recombinant Mouse MUC13 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC13 Products
Required fields are marked with *
My Review for All MUC13 Products
Required fields are marked with *
