Recombinant Human MUC13 protein, His-tagged

• Cat.No.: MUC13-4666H
• Product Overview: Recombinant Human MUC13 protein(Q9H3R2)(322-421 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 322-421 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 12.8 kDa
• AASequence: LTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: MUC13 mucin 13, cell surface associated [ Homo sapiens ]
• Official Symbol: MUC13
• Synonyms: MUC13; mucin 13, cell surface associated; down regulated in colon cancer 1 , DRCC1, mucin 13, epithelial transmembrane; mucin-13; down-regulated in colon cancer 1; mucin 13, epithelial transmembrane; DRCC1; MUC-13; FLJ20063
• Gene ID: 56667
• mRNA Refseq: NM_033049
• Protein Refseq: NP_149038
• MIM: 612181
• UniProt ID: Q9H3R2