"MUC5AC" Related Products

Expand
Expand

Recombinant Human MUC5AC protein, His-tagged

Cat.No.: MUC5AC-16H
Product Overview: Recombinant Human MUC5AC fused with His tag was expressed in E. coli.
Description: Mucin 5AC (Muc5AC) is a protein that in humans is encoded by the MUC5AC gene.
Source: E. coli
Species: Human
Tag: His
Form: In 1M Urea, 50mM Tris pH 8.
Molecular Mass: predicted mol wt 23 kDa
AA Sequence: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
Purity: >80% (SDS-PAGE)
Applications: Suitable as a blocking agent using corresponding antibodies.
Notes: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Storage: storage at −20 centigrade. avoid repeated freeze/thaw cycles.
Concentration: 1 mg/ml
Gene Name: MUC5AC mucin 5AC, oligomeric mucus/gel-forming [ Homo sapiens ]
Official Symbol: MUC5AC
Synonyms: MUC5AC; mucin 5AC, oligomeric mucus/gel-forming; mucin 5, subtypes A and C, tracheobronchial/gastric; mucin-5AC; MUC5; gastric mucin; tracheobronchial mucin; major airway glycoprotein; lewis B blood group antigen; mucin-5 subtype AC, tracheobronchial; mucin 5AC, oligomeric mucus/gel-forming pseudogene; TBM; leB;
Gene ID: 4586
mRNA Refseq: NM_001304359
Protein Refseq: NP_001291288
MIM: 158373
UniProt ID: P98088
Chromosome Location: 11p15.5
Pathway: Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem;
Function: extracellular matrix structural constituent;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.