Recombinant Human MUC5AC protein, His-tagged
Cat.No. : | MUC5AC-16H |
Product Overview : | Recombinant Human MUC5AC fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Mucin 5AC (Muc5AC) is a protein that in humans is encoded by the MUC5AC gene. |
Form : | In 1M Urea, 50mM Tris pH 8. |
Molecular Mass : | predicted mol wt 23 kDa |
AA Sequence : | LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG |
Purity : | >80% (SDS-PAGE) |
Applications : | Suitable as a blocking agent using corresponding antibodies. |
Notes : | The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user. |
Storage : | storage at −20 centigrade. avoid repeated freeze/thaw cycles. |
Concentration : | 1 mg/ml |
Gene Name | MUC5AC mucin 5AC, oligomeric mucus/gel-forming [ Homo sapiens ] |
Official Symbol | MUC5AC |
Synonyms | MUC5AC; mucin 5AC, oligomeric mucus/gel-forming; mucin 5, subtypes A and C, tracheobronchial/gastric; mucin-5AC; MUC5; gastric mucin; tracheobronchial mucin; major airway glycoprotein; lewis B blood group antigen; mucin-5 subtype AC, tracheobronchial; mucin 5AC, oligomeric mucus/gel-forming pseudogene; TBM; leB; |
Gene ID | 4586 |
mRNA Refseq | NM_001304359 |
Protein Refseq | NP_001291288 |
MIM | 158373 |
UniProt ID | P98088 |
Chromosome Location | 11p15.5 |
Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem; |
Function | extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
MUC5AC-12HFL | Recombinant Full length Human MUC5AC Protein, C-MYC/DDK-tagged | +Inquiry |
MUC5AC-17H | Recombinant Human MUC5AC Protein, His-tagged | +Inquiry |
Muc5ac-7624M | Recombinant Mouse Muc5ac protein, His-tagged | +Inquiry |
Muc5ac-5313M | Recombinant Mouse Muc5ac protein, His-tagged | +Inquiry |
Muc5ac-7628R | Recombinant Rat Muc5ac protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC5AC Products
Required fields are marked with *
My Review for All MUC5AC Products
Required fields are marked with *