Recombinant Human MUC5AC protein, His-tagged

• Cat.No.: MUC5AC-16H
• Product Overview: Recombinant Human MUC5AC fused with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Mucin 5AC (Muc5AC) is a protein that in humans is encoded by the MUC5AC gene.
• Form: In 1M Urea, 50mM Tris pH 8.
• Molecular Mass: predicted mol wt 23 kDa
• AA Sequence: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
• Purity: >80% (SDS-PAGE)
• Applications: Suitable as a blocking agent using corresponding antibodies.
• Notes: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
• Storage: storage at −20 centigrade. avoid repeated freeze/thaw cycles.
• Concentration: 1 mg/ml

Gene Information

• Gene Name: MUC5AC mucin 5AC, oligomeric mucus/gel-forming [ Homo sapiens ]
• Official Symbol: MUC5AC
• Synonyms: MUC5AC; mucin 5AC, oligomeric mucus/gel-forming; mucin 5, subtypes A and C, tracheobronchial/gastric; mucin-5AC; MUC5; gastric mucin; tracheobronchial mucin; major airway glycoprotein; lewis B blood group antigen; mucin-5 subtype AC, tracheobronchial; mucin 5AC, oligomeric mucus/gel-forming pseudogene; TBM; leB
• Gene ID: 4586
• mRNA Refseq: NM_001304359
• Protein Refseq: NP_001291288
• MIM: 158373
• UniProt ID: P98088
• Chromosome Location: 11p15.5
• Pathway: Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem
• Function: extracellular matrix structural constituent