Recombinant Human MUC5AC protein, His-tagged
| Cat.No. : | MUC5AC-16H |
| Product Overview : | Recombinant Human MUC5AC fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Mucin 5AC (Muc5AC) is a protein that in humans is encoded by the MUC5AC gene. |
| Form : | In 1M Urea, 50mM Tris pH 8. |
| Molecular Mass : | predicted mol wt 23 kDa |
| AA Sequence : | LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG |
| Purity : | >80% (SDS-PAGE) |
| Applications : | Suitable as a blocking agent using corresponding antibodies. |
| Notes : | The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Storage : | storage at −20 centigrade. avoid repeated freeze/thaw cycles. |
| Concentration : | 1 mg/ml |
| Gene Name | MUC5AC mucin 5AC, oligomeric mucus/gel-forming [ Homo sapiens ] |
| Official Symbol | MUC5AC |
| Synonyms | MUC5AC; mucin 5AC, oligomeric mucus/gel-forming; mucin 5, subtypes A and C, tracheobronchial/gastric; mucin-5AC; MUC5; gastric mucin; tracheobronchial mucin; major airway glycoprotein; lewis B blood group antigen; mucin-5 subtype AC, tracheobronchial; mucin 5AC, oligomeric mucus/gel-forming pseudogene; TBM; leB; |
| Gene ID | 4586 |
| mRNA Refseq | NM_001304359 |
| Protein Refseq | NP_001291288 |
| MIM | 158373 |
| UniProt ID | P98088 |
| Chromosome Location | 11p15.5 |
| Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem; |
| Function | extracellular matrix structural constituent; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC5AC Products
Required fields are marked with *
My Review for All MUC5AC Products
Required fields are marked with *



