Recombinant Human MUL1 protein, His-tagged
| Cat.No. : | MUL1-1111H |
| Product Overview : | Recombinant Human MUL1 protein(27-239 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 27-239 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MUL1 mitochondrial E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
| Official Symbol | MUL1 |
| Synonyms | MUL1; mitochondrial E3 ubiquitin protein ligase 1; C1orf166, chromosome 1 open reading frame 166; mitochondrial ubiquitin ligase activator of NFKB 1; FLJ12875; GIDE; growth inhibition and death E3 ligase; MAPL; mitochondria anchored protein ligase; MULAN; ring finger protein 218; RNF218; E3 ubiquitin ligase; E3 SUMO-protein ligase MUL1; E3 ubiquitin-protein ligase MUL1; mitochondrial E3 ubiquitin ligase 1; mitochondria-anchored protein ligase; mitochondrial-anchored protein ligase; putative NF-kappa-B-activating protein 266; mitochondrial ubiquitin ligase activator of NF-kB; C1orf166; RP11-401M16.2; |
| Gene ID | 79594 |
| mRNA Refseq | NM_024544 |
| Protein Refseq | NP_078820 |
| MIM | 612037 |
| UniProt ID | Q969V5 |
| ◆ Recombinant Proteins | ||
| MUL1-1116H | Recombinant Human MUL1 | +Inquiry |
| MUL1-2206H | Recombinant Human MUL1 Protein, GST-tagged | +Inquiry |
| MUL1-718C | Recombinant Cynomolgus MUL1 Protein, His-tagged | +Inquiry |
| MUL1-10237M | Recombinant Mouse MUL1 Protein | +Inquiry |
| MUL1-2727R | Recombinant Rhesus Macaque MUL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MUL1-4057HCL | Recombinant Human MUL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUL1 Products
Required fields are marked with *
My Review for All MUL1 Products
Required fields are marked with *
