Recombinant Human MUL1 protein, His-tagged

• Cat.No.: MUL1-1111H
• Product Overview: Recombinant Human MUL1 protein(27-239 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 27-239 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MUL1 mitochondrial E3 ubiquitin protein ligase 1 [ Homo sapiens ]
• Official Symbol: MUL1
• Synonyms: MUL1; mitochondrial E3 ubiquitin protein ligase 1; C1orf166, chromosome 1 open reading frame 166; mitochondrial ubiquitin ligase activator of NFKB 1; FLJ12875; GIDE; growth inhibition and death E3 ligase; MAPL; mitochondria anchored protein ligase; MULAN; ring finger protein 218; RNF218; E3 ubiquitin ligase; E3 SUMO-protein ligase MUL1; E3 ubiquitin-protein ligase MUL1; mitochondrial E3 ubiquitin ligase 1; mitochondria-anchored protein ligase; mitochondrial-anchored protein ligase; putative NF-kappa-B-activating protein 266; mitochondrial ubiquitin ligase activator of NF-kB; C1orf166; RP11-401M16.2
• Gene ID: 79594
• mRNA Refseq: NM_024544
• Protein Refseq: NP_078820
• MIM: 612037
• UniProt ID: Q969V5