Recombinant Human MUSK, GST-tagged

• Cat.No.: MUSK-105H
• Product Overview: Human MUSK partial ORF ( NP_005583, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.
• Molecular Mass: 36.63 kDa
• AA Sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLC NHIFQECSPGVVPTPIPICREYCLA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MUSK muscle, skeletal, receptor tyrosine kinase [ Homo sapiens (human) ]
• Official Symbol: MUSK
• Synonyms: MUSK; muscle, skeletal, receptor tyrosine kinase; muscle, skeletal receptor tyrosine-protein kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor; EC 2.7.10.1
• Gene ID: 4593
• mRNA Refseq: NM_005592
• Protein Refseq: NP_005583
• MIM: 601296
• UniProt ID: O15146
• Chromosome Location: 9q31.3-q32
• Pathway: ECM proteoglycans; Extracellular matrix organization
• Function: ATP binding; protein binding; protein tyrosine kinase activity