Recombinant Human MX2

Cat.No. : MX2-30264TH
Product Overview : Recombinant fragment of Human MX2 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSV
Sequence Similarities : Belongs to the dynamin family.Contains 1 GED domain.
Gene Name MX2 myxovirus (influenza virus) resistance 2 (mouse) [ Homo sapiens ]
Official Symbol MX2
Synonyms MX2; myxovirus (influenza virus) resistance 2 (mouse); myxovirus (influenza) resistance 2, homolog of murine; interferon-induced GTP-binding protein Mx2; interferon regulated resistance GTP binding protein MXB; MXB; second interferon induced protein p78;
Gene ID 4600
mRNA Refseq NM_002463
Protein Refseq NP_002454
MIM 147890
Uniprot ID P20592
Chromosome Location 21q22.3
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem;
Function GTP binding; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MX2 Products

Required fields are marked with *

My Review for All MX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon