Recombinant Human MX2
| Cat.No. : | MX2-30264TH |
| Product Overview : | Recombinant fragment of Human MX2 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSV |
| Sequence Similarities : | Belongs to the dynamin family.Contains 1 GED domain. |
| Gene Name | MX2 myxovirus (influenza virus) resistance 2 (mouse) [ Homo sapiens ] |
| Official Symbol | MX2 |
| Synonyms | MX2; myxovirus (influenza virus) resistance 2 (mouse); myxovirus (influenza) resistance 2, homolog of murine; interferon-induced GTP-binding protein Mx2; interferon regulated resistance GTP binding protein MXB; MXB; second interferon induced protein p78; |
| Gene ID | 4600 |
| mRNA Refseq | NM_002463 |
| Protein Refseq | NP_002454 |
| MIM | 147890 |
| Uniprot ID | P20592 |
| Chromosome Location | 21q22.3 |
| Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem; |
| Function | GTP binding; GTPase activity; nucleotide binding; |
| ◆ Cell & Tissue Lysates | ||
| MX2-4048HCL | Recombinant Human MX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MX2 Products
Required fields are marked with *
My Review for All MX2 Products
Required fields are marked with *
