Recombinant Human MX2 Protein, GST-tagged
Cat.No. : | MX2-5772H |
Product Overview : | Human MX2 partial ORF ( NP_002454.1, 521 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MX2 myxovirus (influenza virus) resistance 2 (mouse) [ Homo sapiens ] |
Official Symbol | MX2 |
Synonyms | MX2; myxovirus (influenza virus) resistance 2 (mouse); myxovirus (influenza) resistance 2, homolog of murine; interferon-induced GTP-binding protein Mx2; interferon regulated resistance GTP binding protein MXB; MXB; second interferon induced protein p78; p78-related protein; myxovirus resistance protein 2; second interferon-induced protein p78; interferon-regulated resistance GTP-binding protein MXB; |
Gene ID | 4600 |
mRNA Refseq | NM_002463 |
Protein Refseq | NP_002454 |
MIM | 147890 |
UniProt ID | P20592 |
◆ Recombinant Proteins | ||
MX2-2731R | Recombinant Rhesus Macaque MX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MX2-5018H | Recombinant Human MX2, His-tagged | +Inquiry |
MX2-30264TH | Recombinant Human MX2 | +Inquiry |
MX2-5772H | Recombinant Human MX2 Protein, GST-tagged | +Inquiry |
MX2-1738HFL | Recombinant Full Length Human MX2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MX2-4048HCL | Recombinant Human MX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MX2 Products
Required fields are marked with *
My Review for All MX2 Products
Required fields are marked with *
0
Inquiry Basket