Recombinant Human MXD1 protein, GST-tagged
Cat.No. : | MXD1-301546H |
Product Overview : | Recombinant Human MXD1 (170-221 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp170-Leu221 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MXD1 MAX dimerization protein 1 [ Homo sapiens ] |
Official Symbol | MXD1 |
Synonyms | MXD1; MAX dimerization protein 1; MAD; max dimerization protein 1; bHLHc58; MAD1; max dimerizer 1; MAX-binding protein; antagonizer of myc transcriptional activity; BHLHC58; MGC104659; |
Gene ID | 4084 |
mRNA Refseq | NM_001202513 |
Protein Refseq | NP_001189442 |
MIM | 600021 |
UniProt ID | Q05195 |
◆ Recombinant Proteins | ||
MXD1-3369C | Recombinant Chicken MXD1 | +Inquiry |
MXD1-6631HF | Recombinant Full Length Human MXD1 Protein, GST-tagged | +Inquiry |
MXD1-301546H | Recombinant Human MXD1 protein, GST-tagged | +Inquiry |
MXD1-2502H | Active Recombinant Human MAX Dimerization Protein 1 | +Inquiry |
MXD1-2913R | Recombinant Rhesus monkey MXD1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MXD1-427HCL | Recombinant Human MXD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MXD1 Products
Required fields are marked with *
My Review for All MXD1 Products
Required fields are marked with *