"MXI1" Related Products

Expand
Expand
Expand

Recombinant Human MXI1 protein, His-tagged

Cat.No.: MXI1-481H
Product Overview: Recombinant Human MXI1 fused with His tag at N-terminal was expressed in E. coli.
Description: The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Source: E. coli
Species: Human
Tag: His
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence: MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEE AERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNIST TSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: MXI1 MAX interactor 1 [ Homo sapiens ]
Official Symbol: MXI1
Synonyms: MXI1; MAX interactor 1; MAX interacting protein 1; max-interacting protein 1; bHLHc11; MAD2; MXD2; MXI; MAX dimerization protein 2; Max-related transcription factor; class C basic helix-loop-helix protein 11; MGC43220;
Gene ID: 4601
mRNA Refseq: NM_001008541
Protein Refseq: NP_001008541
MIM: 600020
UniProt ID: P50539
Chromosome Location: 10q24-q25
Function: DNA binding; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.