"MYC" Related Products

Expand
Expand
Expand

Recombinant Human MYC protein, arginine-tagged

Cat.No.: MYC-79H
Product Overview: Recombinant human wild-type cMyc cDNA (454 aa) fused with flexible linker domain & eleven arginine (11R Tag) at C-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.50 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, CaCl2, MgCl2, arginine, DTT, and glycerol.
Bio-activity: Cellular Toxicity: This recombinant protein was tested on mouse embryonic stem cells up to 50 µg/ml in culture medium. Suggested reprogramming protein concentration is between 0.5 to 8 ug / ml for both human and mouse fibroblast cells applications.Biolog
AA Sequence: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMW SGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCAS QDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR NSCAESGGGGSPGRRRRRRRRRRR
Purity: >93% by SDS-PAGE
Applications: 1. May be used for in vitro human cMyc mediated iPS generation mechanism, or its gene specific transcription regulation study with intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for cMyc protein-protein interaction mapping.4. May be used for specific antibody production.
Storage: Recombinant Human c-Myc-11R is stable for six months at -20centigrade to -80centigrade. Store thawed tube at 4centigrade for seven days. Multiple freeze/thaw cycles may result in significant loss of activity.
Gene Name: MYC v-myc myelocytomatosis viral oncogene homolog (avian) [ Homo sapiens ]
Official Symbol: MYC
Synonyms: MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian m
Gene ID: 4609
mRNA Refseq: NM_002467
Protein Refseq: NP_002458
MIM: 190080
UniProt ID: P01106
Chromosome Location: 8q24
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem
Function: DNA binding; DNA binding; E-box binding; protein binding; protein complex binding; repressing transcription factor binding; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.