Recombinant Human MYCBP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MYCBP-6398H
Product Overview : MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
Molecular Mass : 12 kDa
AA Sequence : MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MYCBP c-myc binding protein [ Homo sapiens (human) ]
Official Symbol MYCBP
Synonyms MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056;
Gene ID 26292
mRNA Refseq NM_012333
Protein Refseq NP_036465
MIM 606535
UniProt ID Q99417

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYCBP Products

Required fields are marked with *

My Review for All MYCBP Products

Required fields are marked with *

0
cart-icon
0
compare icon