"MYCBP" Related Products

Expand

Recombinant Human MYCBP Protein, GST-tagged

Cat.No.: MYCBP-5789H
Product Overview: Human MYCBP full-length ORF ( AAH08686, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 37.07 kDa
AA Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MYCBP c-myc binding protein [ Homo sapiens ]
Official Symbol: MYCBP
Synonyms: MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056;
Gene ID: 26292
mRNA Refseq: NM_012333
Protein Refseq: NP_036465
MIM: 606535
UniProt ID: Q99417

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.