Recombinant Human MYCBP Protein, GST-tagged
Cat.No. : | MYCBP-5789H |
Product Overview : | Human MYCBP full-length ORF ( AAH08686, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYCBP c-myc binding protein [ Homo sapiens ] |
Official Symbol | MYCBP |
Synonyms | MYCBP; c-myc binding protein; C-Myc-binding protein; AMY 1; associate of myc 1; associate of myc-1; AMY-1; FLJ41056; |
Gene ID | 26292 |
mRNA Refseq | NM_012333 |
Protein Refseq | NP_036465 |
MIM | 606535 |
UniProt ID | Q99417 |
◆ Recombinant Proteins | ||
MYCBP-6728HF | Recombinant Full Length Human MYCBP Protein, GST-tagged | +Inquiry |
MYCBP-6874H | Recombinant Human C-Myc Binding Protein, His-tagged | +Inquiry |
Mycbp-4240M | Recombinant Mouse Mycbp Protein, Myc/DDK-tagged | +Inquiry |
MYCBP-4750H | Recombinant Human MYCBP protein, His-SUMO-tagged | +Inquiry |
MYCBP-3721Z | Recombinant Zebrafish MYCBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCBP-4038HCL | Recombinant Human MYCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYCBP Products
Required fields are marked with *
My Review for All MYCBP Products
Required fields are marked with *
0
Inquiry Basket