Recombinant Human MYCN protein, His-tagged
Cat.No. : | MYCN-32H |
Product Overview : | Recombinant Human MYCN protein(P04198)(Ser341-Leu440), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341-440 aa |
Form : | Phosphate buffered saline |
Molecular Mass : | 13 kDa |
AASequence : | SEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQL |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCN |
Synonyms | MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc; |
Gene ID | 4613 |
mRNA Refseq | NM_005378 |
Protein Refseq | NP_005369 |
MIM | 164840 |
UniProt ID | P04198 |
◆ Recombinant Proteins | ||
MYCN-3841R | Recombinant Rat MYCN Protein | +Inquiry |
MYCN-3128H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
MYCN-32H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
MYCN-8443H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
MYCN-27993TH | Recombinant Human MYCN protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MYCN-10HFL | Active Recombinant Full Length Human MYCN Protein, GST&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCN-4036HCL | Recombinant Human MYCN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCN Products
Required fields are marked with *
My Review for All MYCN Products
Required fields are marked with *