Recombinant Human MYCN protein, His-tagged

• Cat.No.: MYCN-32H
• Product Overview: Recombinant Human MYCN protein(P04198)(Ser341-Leu440), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 341-440 aa
• Form: Phosphate buffered saline
• Molecular Mass: 13 kDa
• AASequence: SEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQL
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ]
• Official Symbol: MYCN
• Synonyms: MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc
• Gene ID: 4613
• mRNA Refseq: NM_005378
• Protein Refseq: NP_005369
• MIM: 164840
• UniProt ID: P04198