Recombinant Human MYCN protein, His-tagged
Cat.No. : | MYCN-3128H |
Product Overview : | Recombinant Human MYCN protein(289 - 464 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 289 - 464 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCN |
Synonyms | MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; pp65/67; oncogene NMYC; neuroblastoma MYC oncogene; class E basic helix-loop-helix protein 37; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; NMYC; ODED; MODED; N-myc; |
Gene ID | 4613 |
mRNA Refseq | NM_005378 |
Protein Refseq | NP_005369 |
MIM | 164840 |
UniProt ID | P04198 |
◆ Recombinant Proteins | ||
MYCN-10290M | Recombinant Mouse MYCN Protein | +Inquiry |
MYCN-7006HF | Recombinant Full Length Human MYCN Protein, GST-tagged | +Inquiry |
MYCN-3128H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
MYCN-27993TH | Recombinant Human MYCN protein, GST-tagged | +Inquiry |
MYCN-30409TH | Recombinant Human MYCN | +Inquiry |
◆ Native Proteins | ||
MYCN-10HFL | Active Recombinant Full Length Human MYCN Protein, GST&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCN-4036HCL | Recombinant Human MYCN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCN Products
Required fields are marked with *
My Review for All MYCN Products
Required fields are marked with *