Recombinant Human MYF6
Cat.No. : | MYF6-29361TH |
Product Overview : | Recombinant fragment of Human MYF6 with N terminal proprietary tag, predicted mwt: 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | MYF6 myogenic factor 6 (herculin) [ Homo sapiens ] |
Official Symbol | MYF6 |
Synonyms | MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; |
Gene ID | 4618 |
mRNA Refseq | NM_002469 |
Protein Refseq | NP_002460 |
MIM | 159991 |
Uniprot ID | P23409 |
Chromosome Location | 12q21 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; contributes_to E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MYF6-10297M | Recombinant Mouse MYF6 Protein | +Inquiry |
MYF6-3503R | Recombinant Rat MYF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYF6-29361TH | Recombinant Human MYF6 | +Inquiry |
MYF6-5801H | Recombinant Human MYF6 Protein, GST-tagged | +Inquiry |
MYF6-2447C | Recombinant Chicken MYF6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYF6-4033HCL | Recombinant Human MYF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYF6 Products
Required fields are marked with *
My Review for All MYF6 Products
Required fields are marked with *
0
Inquiry Basket