Recombinant Human MYH7, GST-tagged

Cat.No. : MYH7-56H
Product Overview : Recombinant Human MYH7(1 a.a. - 109 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy.
Molecular Mass : 37.73 kDa
AA Sequence : MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQ VMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYH7 myosin, heavy chain 7, cardiac muscle, beta [ Homo sapiens(human) ]
Official Symbol MYH7
Synonyms MYH7; CMH1; MPD1; SPMD; SPMM; CMD1S; MYHCB; myosin, heavy chain 7, cardiac muscle, beta; myosin-7; myHC-beta; myhc-slow; myopathy, distal 1; myosin heavy chain 7; beta-myosin heavy chain; myosin heavy chain (AA 1-96); myosin heavy chain slow isoform; rhabdomyosarcoma antigen MU-RMS-40.7A; myosin heavy chain, cardiac muscle beta isoform; myosin, heavy polypeptide 7, cardiac muscle, beta
Gene ID 4625
mRNA Refseq NM_000257
Protein Refseq NP_000248
MIM 160760
UniProt ID P12883
Chromosome Location 14q12
Pathway Cardiac muscle contraction; Dilated cardiomyopathy; Hypertrophic cardiomyopathy (HCM)
Function ATP binding; ATPase activity; actin-dependent ATPase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYH7 Products

Required fields are marked with *

My Review for All MYH7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon