Recombinant Human MYH7, GST-tagged
Cat.No. : | MYH7-56H |
Product Overview : | Recombinant Human MYH7(1 a.a. - 109 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQ VMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRY |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYH7 myosin, heavy chain 7, cardiac muscle, beta [ Homo sapiens(human) ] |
Official Symbol | MYH7 |
Synonyms | MYH7; CMH1; MPD1; SPMD; SPMM; CMD1S; MYHCB; myosin, heavy chain 7, cardiac muscle, beta; myosin-7; myHC-beta; myhc-slow; myopathy, distal 1; myosin heavy chain 7; beta-myosin heavy chain; myosin heavy chain (AA 1-96); myosin heavy chain slow isoform; rhabdomyosarcoma antigen MU-RMS-40.7A; myosin heavy chain, cardiac muscle beta isoform; myosin, heavy polypeptide 7, cardiac muscle, beta |
Gene ID | 4625 |
mRNA Refseq | NM_000257 |
Protein Refseq | NP_000248 |
MIM | 160760 |
UniProt ID | P12883 |
Chromosome Location | 14q12 |
Pathway | Cardiac muscle contraction; Dilated cardiomyopathy; Hypertrophic cardiomyopathy (HCM) |
Function | ATP binding; ATPase activity; actin-dependent ATPase activity |
◆ Recombinant Proteins | ||
MYH7-2387H | Recombinant Human MYH7 Protein (Arg1268-Leu1516), His tagged | +Inquiry |
MYH7-8021H | Recombinant Human MYH7 protein, His-tagged | +Inquiry |
MYH7-8020H | Recombinant Human MYH7 protein, His-tagged | +Inquiry |
MYH7-1087C | Recombinant Chicken MYH7 | +Inquiry |
MYH7-3849R | Recombinant Rat MYH7 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH7 Products
Required fields are marked with *
My Review for All MYH7 Products
Required fields are marked with *
0
Inquiry Basket