Recombinant Human MYH9, GST-tagged
| Cat.No. : | MYH9-30H |
| Product Overview : | Recombinant Human MYH9, fused with N-terminal GST, was expressed in E. coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Description : | This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
| AA Sequence : | EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAK IAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRAN ASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | Upon receipt, store it immediately at -20°C to -80°C. |
| Gene Name | MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ] |
| Official Symbol | MYH9 |
| Synonyms | MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A |
| Gene ID | 4627 |
| mRNA Refseq | NM_002473 |
| Protein Refseq | NP_002464 |
| MIM | 160775 |
| UniProt ID | P35579 |
| Chromosome Location | 22q13.1 |
| Pathway | Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton |
| Function | ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity |
| ◆ Recombinant Proteins | ||
| MYH9-30H | Recombinant Human MYH9, GST-tagged | +Inquiry |
| MYH9-31H | Recombinant Human MYH9, GST-tagged | +Inquiry |
| MYH9-32H | Recombinant Human MYH9 protein, His-SUMO-tagged | +Inquiry |
| Myh9-5950R | Recombinant Rat Myh9 protein, His&Myc-tagged | +Inquiry |
| MYH9-7026C | Recombinant Chicken MYH9 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH9 Products
Required fields are marked with *
My Review for All MYH9 Products
Required fields are marked with *
