Recombinant Human MYH9, GST-tagged

Cat.No. : MYH9-30H
Product Overview : Recombinant Human MYH9, fused with N-terminal GST, was expressed in E. coli.
Availability January 21, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAK IAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRAN ASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Shipping : Upon receipt, store it immediately at -20°C to -80°C.
Gene Name MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ]
Official Symbol MYH9
Synonyms MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A
Gene ID 4627
mRNA Refseq NM_002473
Protein Refseq NP_002464
MIM 160775
UniProt ID P35579
Chromosome Location 22q13.1
Pathway Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton
Function ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYH9 Products

Required fields are marked with *

My Review for All MYH9 Products

Required fields are marked with *

0
cart-icon
0
compare icon