Recombinant Human MYL1 protein, GST-tagged
Cat.No. : | MYL1-3261H |
Product Overview : | Recombinant Human MYL1 protein(P05976)(1-150aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-150aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MYL1 myosin, light chain 1, alkali; skeletal, fast [ Homo sapiens ] |
Official Symbol | MYL1 |
Synonyms | MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F; |
Gene ID | 4632 |
mRNA Refseq | NM_079420 |
Protein Refseq | NP_524144 |
MIM | 160780 |
UniProt ID | P05976 |
◆ Recombinant Proteins | ||
MYL1-6758HF | Recombinant Full Length Human MYL1 Protein, GST-tagged | +Inquiry |
MYL1-10310M | Recombinant Mouse MYL1 Protein | +Inquiry |
MYL1-5806H | Recombinant Human MYL1 Protein, GST-tagged | +Inquiry |
MYL1-10361Z | Recombinant Zebrafish MYL1 | +Inquiry |
Myl1-1508R | Recombinant Rat Myl1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL1-4031HCL | Recombinant Human MYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL1 Products
Required fields are marked with *
My Review for All MYL1 Products
Required fields are marked with *
0
Inquiry Basket