Recombinant Human MYL12A protein, His-tagged

• Cat.No.: MYL12A-843H
• Product Overview: Recombinant Human MYL12A protein(P19105)(1-171aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-171a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 渭g/mL can bind Anti-MYL9 recombinant antibody. The EC50 is 5.325-6.456 ng/mL.
• Molecular Mass: 26.7 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Gene Information

• Gene Name: MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ]
• Official Symbol: MYL12A
• Synonyms: MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3; MLC-2B; myosin RLC; myosin regulatory light chain MRCL3; myosin regulatory light chain MRLC3; myosin regulatory light chain 2, nonsarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
• Gene ID: 10627
• mRNA Refseq: NM_006471
• Protein Refseq: NP_006462
• UniProt ID: P19105