Recombinant Human MYL6B, His-tagged

Cat.No. : MYL6B-30243TH
Product Overview : Recombinant full length Human MLC1SA with an N terminal His tag; 231 amino acids with the tag; predicted MWt: 25.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 208 amino acids
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 25.200kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ]
Official Symbol MYL6B
Synonyms MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a;
Gene ID 140465
mRNA Refseq NM_001199629
Protein Refseq NP_001186558
MIM 609930
Uniprot ID P14649
Chromosome Location 12q13.2
Pathway Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function calcium ion binding; motor activity; protein binding; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL6B Products

Required fields are marked with *

My Review for All MYL6B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon