Recombinant Human MYL6B, His-tagged
| Cat.No. : | MYL6B-30243TH |
| Product Overview : | Recombinant full length Human MLC1SA with an N terminal His tag; 231 amino acids with the tag; predicted MWt: 25.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 208 amino acids |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. |
| Conjugation : | HIS |
| Molecular Weight : | 25.200kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV |
| Sequence Similarities : | Contains 3 EF-hand domains. |
| Gene Name | MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
| Official Symbol | MYL6B |
| Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; |
| Gene ID | 140465 |
| mRNA Refseq | NM_001199629 |
| Protein Refseq | NP_001186558 |
| MIM | 609930 |
| Uniprot ID | P14649 |
| Chromosome Location | 12q13.2 |
| Pathway | Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem; |
| Function | calcium ion binding; motor activity; protein binding; structural constituent of muscle; |
| ◆ Recombinant Proteins | ||
| MYL6B-10318M | Recombinant Mouse MYL6B Protein | +Inquiry |
| MYL6B-4022H | Recombinant Human MYL6B Protein (Lys5-Glu199), N-His tagged | +Inquiry |
| MYL6B-5380H | Recombinant Human MYL6B Protein, GST-tagged | +Inquiry |
| MYL6B-4666H | Recombinant Human MYL6B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYL6B-2924R | Recombinant Rhesus monkey MYL6B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *



