Recombinant Human MYL9 protein, His-tagged
Cat.No. : | MYL9-6744H |
Product Overview : | Recombinant Human MYL9 protein(P24844)(2-172aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-172aa |
Tag : | C-His |
Form : | Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 ug/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 4.628-6.430 ng/mL. |
Molecular Mass : | 21.7kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
Gene Name | MYL9 myosin, light chain 9, regulatory [ Homo sapiens ] |
Official Symbol | MYL9 |
Synonyms | MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505; |
Gene ID | 10398 |
mRNA Refseq | NM_006097 |
Protein Refseq | NP_006088 |
MIM | 609905 |
UniProt ID | P24844 |
◆ Recombinant Proteins | ||
MYL9-3857R | Recombinant Rat MYL9 Protein | +Inquiry |
MYL9-5817H | Recombinant Human MYL9 Protein, GST-tagged | +Inquiry |
MYL9-6744H | Recombinant Human MYL9 protein, His-tagged | +Inquiry |
MYL9-3445H | Recombinant Human MYL9 protein, His-tagged | +Inquiry |
MYL9-6830C | Recombinant Chicken MYL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL9-4020HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
MYL9-4019HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL9 Products
Required fields are marked with *
My Review for All MYL9 Products
Required fields are marked with *