Recombinant Human MYL9 protein, His-tagged

Cat.No. : MYL9-6744H
Product Overview : Recombinant Human MYL9 protein(P24844)(2-172aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-172aa
Tag : C-His
Form : Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 ug/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 4.628-6.430 ng/mL.
Molecular Mass : 21.7kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Gene Name MYL9 myosin, light chain 9, regulatory [ Homo sapiens ]
Official Symbol MYL9
Synonyms MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505;
Gene ID 10398
mRNA Refseq NM_006097
Protein Refseq NP_006088
MIM 609905
UniProt ID P24844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL9 Products

Required fields are marked with *

My Review for All MYL9 Products

Required fields are marked with *

0
cart-icon