Recombinant Human MYLPF protein, GST-tagged
Cat.No. : | MYLPF-7855H |
Product Overview : | Recombinant Human MYLPF protein(1-169 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-169 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | MYLPF |
Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; MLC2B; myosin light chain 2; fast skeletal myosin light chain 2; myosin, light chain 11, regulatory; MGC13450; DKFZp779C0757; |
Gene ID | 29895 |
mRNA Refseq | NM_013292 |
Protein Refseq | NP_037424 |
UniProt ID | Q96A32 |
◆ Recombinant Proteins | ||
MYLPF-10325M | Recombinant Mouse MYLPF Protein | +Inquiry |
MYLPF-3519R | Recombinant Rat MYLPF Protein, His (Fc)-Avi-tagged | +Inquiry |
MYLPF-5827H | Recombinant Human MYLPF Protein, GST-tagged | +Inquiry |
MYLPF-5081H | Recombinant Human Myosin Light Chain, Phosphorylatable, Fast Skeletal Muscle, His-tagged | +Inquiry |
MYLPF-7855H | Recombinant Human MYLPF protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *
0
Inquiry Basket