Recombinant Human MYO1A
Cat.No. : | MYO1A-30273TH |
Product Overview : | Recombinant fragment of Human MYO1A with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene belongs to the myosin superfamily. Myosins are molecular motors that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force. Each myosin has a conserved N-terminal motor domain that contains both ATP-binding and actin-binding sequences. Following the motor domain is a light-chain-binding neck region containing 1-6 copies of a repeat element, the IQ motif, that serves as a binding site for calmodulin or other members of the EF-hand superfamily of calcium-binding proteins. At the C-terminus, each myosin class has a distinct tail domain that serves in dimerization, membrane binding, protein binding, and/or enzymatic activities and targets each myosin to its particular subcellular location. The kidney epithelial cell line, LLC-PK1-CL4 (CL4), forms a well ordered brush border (BB) on its apical surface. Experiments indicate that the brush border population of the encoded protein turns over rapidly, while its head and tail domains interact transiently with the core actin and plasma membrane, respectively. A rapidly exchanging pool of the protein encoded by this gene envelops an actin core bundle that, by comparison, is static in structure. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ |
Sequence Similarities : | Contains 3 IQ domains.Contains 1 myosin head-like domain. |
Gene Name | MYO1A myosin IA [ Homo sapiens ] |
Official Symbol | MYO1A |
Synonyms | MYO1A; myosin IA; DFNA48, MYHL; myosin-Ia; |
Gene ID | 4640 |
mRNA Refseq | NM_005379 |
Protein Refseq | NP_005370 |
MIM | 601478 |
Uniprot ID | Q9UBC5 |
Chromosome Location | 12q13-q15 |
Function | ATP binding; actin binding; calmodulin binding; motor activity; nucleotide binding; |
◆ Recombinant Proteins | ||
Myo1a-538M | Recombinant Mouse Myo1a Protein, His-tagged | +Inquiry |
MYO1A-537H | Recombinant Human MYO1A Protein, His-tagged | +Inquiry |
MYO1A-5857M | Recombinant Mouse MYO1A Protein, His (Fc)-Avi-tagged | +Inquiry |
MYO1A-6719C | Recombinant Chicken MYO1A | +Inquiry |
MYO1A-10333M | Recombinant Mouse MYO1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO1A-4010HCL | Recombinant Human MYO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYO1A Products
Required fields are marked with *
My Review for All MYO1A Products
Required fields are marked with *
0
Inquiry Basket