Recombinant Human MYO5A Protein, GST-tagged

Cat.No. : MYO5A-5841H
Product Overview : Human MYO5A partial ORF ( NP_000250.1, 1758 a.a. - 1853 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. [provided by RefSeq
Molecular Mass : 36.3 kDa
AA Sequence : KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO5A myosin VA (heavy chain 12, myoxin) [ Homo sapiens ]
Official Symbol MYO5A
Synonyms MYO5A; myosin VA (heavy chain 12, myoxin); MYH12, myosin VA (heavy polypeptide 12, myoxin); unconventional myosin-Va; GS1; MYO5; myosin heavy chain 12; myosin V; myosin; heavy polypeptide kinase; myoxin; MYR12; myosin-12; myosin-Va; myosin, heavy polypeptide kinase; dilute myosin heavy chain, non-muscle; MYH12;
Gene ID 4644
mRNA Refseq NM_000259
Protein Refseq NP_000250
MIM 160777
UniProt ID Q9Y4I1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO5A Products

Required fields are marked with *

My Review for All MYO5A Products

Required fields are marked with *

0
cart-icon
0
compare icon