Recombinant Human Myosin, Light Chain 1, His-tagged

Cat.No. : MYL1-4457H
Product Overview : Recombinant human MYL1 protein with a His-tag was expressed in E. coli
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
Molecular Mass : The protein has a calculated MW of 23.3 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from 10mM Tris -HCI, 1mM EDTA PH 7.5, 5% trehalose, 5% manitol
Gene Name MYL1 myosin, light chain 1, alkali; skeletal, fast [ Homo sapiens (human) ]
Official Symbol MYL1
Synonyms MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F;
Gene ID 4632
mRNA Refseq NM_079420
Protein Refseq NP_524144
MIM 160780
UniProt ID P05976

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL1 Products

Required fields are marked with *

My Review for All MYL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon