Recombinant Human Myosin, Light Chain 1, His-tagged
| Cat.No. : | MYL1-4457H |
| Product Overview : | Recombinant human MYL1 protein with a His-tag was expressed in E. coli |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. |
| Molecular Mass : | The protein has a calculated MW of 23.3 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from 10mM Tris -HCI, 1mM EDTA PH 7.5, 5% trehalose, 5% manitol |
| Gene Name | MYL1 myosin, light chain 1, alkali; skeletal, fast [ Homo sapiens (human) ] |
| Official Symbol | MYL1 |
| Synonyms | MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F; |
| Gene ID | 4632 |
| mRNA Refseq | NM_079420 |
| Protein Refseq | NP_524144 |
| MIM | 160780 |
| UniProt ID | P05976 |
| ◆ Recombinant Proteins | ||
| MYL1-5806H | Recombinant Human MYL1 Protein, GST-tagged | +Inquiry |
| MYL1-29363TH | Recombinant Human MYL1 | +Inquiry |
| MYL1-10310M | Recombinant Mouse MYL1 Protein | +Inquiry |
| MYL1-5843M | Recombinant Mouse MYL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYL1-10361Z | Recombinant Zebrafish MYL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL1-4031HCL | Recombinant Human MYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL1 Products
Required fields are marked with *
My Review for All MYL1 Products
Required fields are marked with *
