Recombinant Human MYOZ1 Protein, GST-tagged
Cat.No. : | MYOZ1-5858H |
Product Overview : | Human MYOZ1 full-length ORF ( NP_067068.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012] |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYOZ1 myozenin 1 [ Homo sapiens ] |
Official Symbol | MYOZ1 |
Synonyms | MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ; |
Gene ID | 58529 |
mRNA Refseq | NM_021245 |
Protein Refseq | NP_067068 |
MIM | 605603 |
UniProt ID | Q9NP98 |
◆ Recombinant Proteins | ||
MYOZ1-6619HF | Recombinant Full Length Human MYOZ1 Protein, GST-tagged | +Inquiry |
MYOZ1-10356M | Recombinant Mouse MYOZ1 Protein | +Inquiry |
MYOZ1-5870M | Recombinant Mouse MYOZ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Myoz1-4262M | Recombinant Mouse Myoz1 Protein, Myc/DDK-tagged | +Inquiry |
MYOZ1-3943H | Recombinant Human MYOZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOZ1-4002HCL | Recombinant Human MYOZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOZ1 Products
Required fields are marked with *
My Review for All MYOZ1 Products
Required fields are marked with *