Recombinant Human MYOZ2 protein, T7-tagged

• Cat.No.: MYOZ2-160H
• Product Overview: Recombinant human MYOZ2 (264 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 264 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKM RQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIP PEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFE LLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro calcium-dependent signal transduction pathway regulation study for cardiomyocytes with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping MYOZ2 protein-protein interaction.4. Potential biomarker protein for monitoring human cardiomyocytes damage in various diseases.5. May be used as antigen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: MYOZ2 myozenin 2 [ Homo sapiens ]
• Official Symbol: MYOZ2
• Synonyms: MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; CS-1; CMH16; C4orf5
• Gene ID: 51778
• mRNA Refseq: NM_016599
• Protein Refseq: NP_057683
• MIM: 605602
• UniProt ID: Q9NPC6
• Chromosome Location: 4q26-q27
• Function: protein binding; protein phosphatase 2B binding