Recombinant Human MYOZ2 protein, T7-tagged

Cat.No. : MYOZ2-160H
Product Overview : Recombinant human MYOZ2 (264 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 264 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKM RQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIP PEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFE LLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro calcium-dependent signal transduction pathway regulation study for cardiomyocytes with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping MYOZ2 protein-protein interaction.4. Potential biomarker protein for monitoring human cardiomyocytes damage in various diseases.5. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name MYOZ2 myozenin 2 [ Homo sapiens ]
Official Symbol MYOZ2
Synonyms MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; CS-1; CMH16; C4orf5;
Gene ID 51778
mRNA Refseq NM_016599
Protein Refseq NP_057683
MIM 605602
UniProt ID Q9NPC6
Chromosome Location 4q26-q27
Function protein binding; protein phosphatase 2B binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOZ2 Products

Required fields are marked with *

My Review for All MYOZ2 Products

Required fields are marked with *

0
cart-icon