"MYOZ2" Related Products

Recombinant Human MYOZ2 protein, T7-tagged

Cat.No.: MYOZ2-160H
Product Overview: Recombinant human MYOZ2 (264 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKM RQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIP PEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFE LLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro calcium-dependent signal transduction pathway regulation study for cardiomyocytes with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping MYOZ2 protein-protein interaction.4. Potential biomarker protein for monitoring human cardiomyocytes damage in various diseases.5. May be used as antigen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: MYOZ2 myozenin 2 [ Homo sapiens ]
Official Symbol: MYOZ2
Synonyms: MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; CS-1; CMH16; C4orf5;
Gene ID: 51778
mRNA Refseq: NM_016599
Protein Refseq: NP_057683
MIM: 605602
UniProt ID: Q9NPC6
Chromosome Location: 4q26-q27
Function: protein binding; protein phosphatase 2B binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.