Recombinant Human NAB2

Cat.No. : NAB2-28773TH
Product Overview : Recombinant fragment of Human Nab2 (amino acids 421-525) with N terminal proprietary tag, 37.18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 105 amino acids
Description : This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Molecular Weight : 37.180kDa inclusive of tags
Tissue specificity : Widely expressed at low levels. Highly expressed in melanoma cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLM DEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCP APGPHPALVEGRRSSVKVEAEASRQ
Sequence Similarities : Belongs to the NAB family.
Gene Name NAB2 NGFI-A binding protein 2 (EGR1 binding protein 2) [ Homo sapiens ]
Official Symbol NAB2
Synonyms NAB2; NGFI-A binding protein 2 (EGR1 binding protein 2); NGFI-A-binding protein 2; MADER;
Gene ID 4665
mRNA Refseq NM_005967
Protein Refseq NP_005958
MIM 602381
Uniprot ID Q15742
Chromosome Location 12q13.3
Function transcription corepressor activity; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAB2 Products

Required fields are marked with *

My Review for All NAB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon