Recombinant Human NACA, His-tagged

Cat.No. : NACA-27839TH
Product Overview : Recombinant full-length Human NACA1 with a N terminal His tag; 235 amino acids with a predicted MWt 25.5 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 215 amino acids
Description : The protein encoded by this gene associates with basic transcription factor 3 (BTF3) to form the nascent polypeptide-associated complex (NAC). NAC binds to nascent proteins as they emerge from the ribosome, blocking interaction with the signal recognition particle (SRP) and preventing mistranslocation to the endoplasmic reticulum. However, nascent proteins with an exposed signal peptide will not be bound by the encoded protein, enabling them to bind the SRP and enter the secretory pathway. This protein has been determined to be an IgE autoantigen in atopic dermatitis patients. Several transcript variants encoding two different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 25.500kDa inclusive of tags
Tissue specificity : Ubiquitously expressed.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPGEATETVPATEQELPQPQ AETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEID EEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSK NILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAA EKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKD IELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM
Sequence Similarities : Belongs to the NAC-alpha family.Contains 1 NAC-A/B (NAC-alpha/beta) domain.Contains 1 UBA domain.
Gene Name NACA nascent polypeptide-associated complex alpha subunit [ Homo sapiens ]
Official Symbol NACA
Synonyms NACA; nascent polypeptide-associated complex alpha subunit; nascent polypeptide associated complex alpha polypeptide; nascent polypeptide-associated complex subunit alpha; NACA1;
Gene ID 4666
mRNA Refseq NM_001113202
Protein Refseq NP_001106673
MIM 601234
Uniprot ID Q13765
Chromosome Location 12q23-q24.1
Function DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NACA Products

Required fields are marked with *

My Review for All NACA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon