Recombinant Human NACA, His-tagged
Cat.No. : | NACA-27839TH |
Product Overview : | Recombinant full-length Human NACA1 with a N terminal His tag; 235 amino acids with a predicted MWt 25.5 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 215 amino acids |
Description : | The protein encoded by this gene associates with basic transcription factor 3 (BTF3) to form the nascent polypeptide-associated complex (NAC). NAC binds to nascent proteins as they emerge from the ribosome, blocking interaction with the signal recognition particle (SRP) and preventing mistranslocation to the endoplasmic reticulum. However, nascent proteins with an exposed signal peptide will not be bound by the encoded protein, enabling them to bind the SRP and enter the secretory pathway. This protein has been determined to be an IgE autoantigen in atopic dermatitis patients. Several transcript variants encoding two different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 25.500kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPGEATETVPATEQELPQPQ AETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEID EEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSK NILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAA EKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKD IELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM |
Sequence Similarities : | Belongs to the NAC-alpha family.Contains 1 NAC-A/B (NAC-alpha/beta) domain.Contains 1 UBA domain. |
Gene Name | NACA nascent polypeptide-associated complex alpha subunit [ Homo sapiens ] |
Official Symbol | NACA |
Synonyms | NACA; nascent polypeptide-associated complex alpha subunit; nascent polypeptide associated complex alpha polypeptide; nascent polypeptide-associated complex subunit alpha; NACA1; |
Gene ID | 4666 |
mRNA Refseq | NM_001113202 |
Protein Refseq | NP_001106673 |
MIM | 601234 |
Uniprot ID | Q13765 |
Chromosome Location | 12q23-q24.1 |
Function | DNA binding; |
◆ Recombinant Proteins | ||
Naca-4277M | Recombinant Mouse Naca Protein, Myc/DDK-tagged | +Inquiry |
NACA-2536H | Recombinant Human NACA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NACA-5763H | Recombinant Human NACA protein, His-tagged | +Inquiry |
NACA-821H | Recombinant Human NACA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NACA-7783Z | Recombinant Zebrafish NACA | +Inquiry |
◆ Cell & Tissue Lysates | ||
NACA-2129HCL | Recombinant Human NACA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NACA Products
Required fields are marked with *
My Review for All NACA Products
Required fields are marked with *
0
Inquiry Basket